PDB entry 6d0q

View 6d0q on RCSB PDB site
Description: Structure of a DNA retention-prone PCNA variant
Class: replication
Keywords: Mutant, DNA, REPLICATION
Deposited on 2018-04-10, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (6-263)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d6d0qa1, d6d0qa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d0qA (A:)
    gphmasmleakfeeaslfkriidgfkkcvqlvnfqckedgiiaqavddsrvllvsleigv
    eafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaey
    slklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgd
    igsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseap
    alfqfdlksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d0qA (A:)
    mleakfeeaslfkriidgfkkcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee