PDB entry 6d0b

View 6d0b on RCSB PDB site
Description: Crystal structure of PT1614 bound to HIF2a-B*:ARNT-B* complex
Class: transcription
Keywords: Hif2a, Pas B domain, ARNT, hypoxia inducible factor, EPAS1, TRANSCRIPTION
Deposited on 2018-04-10, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial PAS domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPAS1, BHLHE73, HIF2A, MOP2, PASD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99814 (5-End)
      • expression tag (2-4)
      • engineered mutation (13)
    Domains in SCOPe 2.07: d6d0ba1, d6d0ba2
  • Chain 'B':
    Compound: Aryl hydrocarbon receptor nuclear translocator
    Species: Homo sapiens [TaxId:9606]
    Gene: ARNT, BHLHE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27540
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6d0bb_
  • Heterogens: FOV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d0bA (A:)
    gefkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtksh
    qnlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d0bA (A:)
    fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
    lctkgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlseie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d0bB (B:)
    gefkglnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllr
    dsfqqvvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknssq
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d0bB (B:)
    cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
    lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns