PDB entry 6d0a

View 6d0a on RCSB PDB site
Description: Crystal structure of Kynurenine Aminotransferase-II in apo-form, at 1.47 A resolution
Class: transferase
Keywords: Transferase, PLP-dependent, hexahistidine tag, alpha-beta fold
Deposited on 2018-04-10, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5Z0 (6-430)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d6d0aa1, d6d0aa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d0aA (A:)
    hhhhhhmnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavit
    vengktiqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvt
    sgsqqglckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdi
    lsrwkpedaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyy
    flqfnkfrvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlh
    pstfnqlmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagm
    flwikvkgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvaf
    qvlaqlikesl