PDB entry 6czz

View 6czz on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana phosphoserine aminotransferase isoform 1 (AtPSAT1) in complex with PLP-phosphoserine geminal diamine intermediate
Class: transferase
Keywords: serine biosynthesis, pyridoxal 5'-phosphate, PLP, transaminase, PSAT, TRANSFERASE
Deposited on 2018-04-09, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (2)
    Domains in SCOPe 2.07: d6czza1, d6czza2
  • Chain 'B':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (2)
    Domains in SCOPe 2.07: d6czzb1, d6czzb2
  • Chain 'C':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (2)
    Domains in SCOPe 2.07: d6czzc1, d6czzc2
  • Chain 'D':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (2)
    Domains in SCOPe 2.07: d6czzd1, d6czzd2
  • Heterogens: PLP, SEP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6czzA (A:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czzA (A:)
    arvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrqll
    eipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviws
    gksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcskp
    vdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntppc
    fgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvpf
    tlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6czzB (B:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czzB (B:)
    arvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrqll
    eipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviws
    gksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcskp
    vdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntppc
    fgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvpf
    tlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6czzC (C:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czzC (C:)
    arvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrqll
    eipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviws
    gksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcskp
    vdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntppc
    fgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvpf
    tlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6czzD (D:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czzD (D:)
    arvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrqll
    eipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviws
    gksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcskp
    vdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntppc
    fgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvpf
    tlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakha