PDB entry 6czy

View 6czy on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana phosphoserine aminotransferase isoform 1 (AtPSAT1) in complex with Pyridoxamine-5'-phosphate (PMP)
Class: transferase
Keywords: serine biosynthesis, pyridoxal 5'-phosphate, PLP, transaminase, PSAT, pyridoxamine, PMP, TRANSFERASE
Deposited on 2018-04-09, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6czya1, d6czya2
  • Chain 'B':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6czyb1, d6czyb2
  • Chain 'C':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6czyc1, d6czyc2
  • Chain 'D':
    Compound: Phosphoserine aminotransferase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PSAT1, At4g35630, F8D20.140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96255 (3-361)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6czyd1, d6czyd2
  • Heterogens: PMP, SO4, PEG, NA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6czyA (A:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6czyB (B:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czyB (B:)
    narvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrql
    leipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviw
    sgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcsk
    pvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntpp
    cfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvp
    ftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakh
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6czyC (C:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czyC (C:)
    narvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrql
    leipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviw
    sgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcsk
    pvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntpp
    cfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvp
    ftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakh
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6czyD (D:)
    snarvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrq
    lleipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnvi
    wsgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcs
    kpvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntp
    pcfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnv
    pftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqak
    ha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czyD (D:)
    narvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrql
    leipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviw
    sgksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcsk
    pvdvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntpp
    cfgiymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvp
    ftlekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakh
    a