PDB entry 6czo

View 6czo on RCSB PDB site
Description: The KNL1-PP1 Holoenzyme
Class: hydrolase
Keywords: PHOSPHATASE, REGULATOR, SLIM, Kinetochore, HYDROLASE
Deposited on 2018-04-09, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62136 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d6czoa1, d6czoa2
  • Chain 'B':
    Compound: CASC5 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CASC5
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62136 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d6czoc1, d6czoc2
  • Chain 'D':
    Compound: CASC5 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CASC5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6czoA (A:)
    ghmgslnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplki
    cgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffll
    rgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlq
    smeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdl
    dlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czoA (A:)
    slnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
    hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
    ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
    irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
    rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6czoC (C:)
    ghmgslnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplki
    cgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffll
    rgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlq
    smeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdl
    dlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czoC (C:)
    slnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
    hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
    ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
    irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
    rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp
    

  • Chain 'D':
    No sequence available.