PDB entry 6cz3

View 6cz3 on RCSB PDB site
Description: Structure of the PTK6 kinase domain bound to a type I inhibitor (3-fluoro-4-{[6-methyl-3-(1H-pyrazol-4-yl)imidazo[1,2-a]pyrazin-8-yl]amino}phenyl)(morpholin-4-yl)methanone
Class: Transferase/Transferase Inhibitor
Keywords: Protein kinase, PTK6, Transferase-Transferase Inhibitor complex
Deposited on 2018-04-07, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-tyrosine kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK6, BRK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13882 (2-263)
      • conflict (4)
    Domains in SCOPe 2.07: d6cz3a_
  • Heterogens: FLJ, ACT, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cz3A (A:)
    gsddaerpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqam
    kklrhkhilalyavvsvgdpvyiitelmakgsllellrdsdekvlpvselldiawqvaeg
    mcylesqnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapeal
    srghystksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhkl
    mltcwcrdpeqrpcfkalrerlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cz3A (A:)
    ddaerpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkk
    lrhkhilalyavvsvgdpvyiitelmakgsllellrdsdekvlpvselldiawqvaegmc
    ylesqnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsr
    ghystksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklml
    tcwcrdpeqrpcfkalrerlss