PDB entry 6cz1

View 6cz1 on RCSB PDB site
Description: Crystal structure of ATPase domain of Human GRP78 bound to Ver155008
Class: chaperone
Keywords: GRP78, Chaperone, ATPase domain, Ver155008
Deposited on 2018-04-07, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.6800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cz1a1, d6cz1a2
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cz1b1, d6cz1b2
  • Heterogens: 3FD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cz1A (A:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cz1B (B:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cz1B (B:)
    vgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
    npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
    amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
    iaygldkregeknilvfdlgggtfdvslltdngvfevvatngdthlggedfdqrvmehfi
    klykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakf
    eelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrg
    inpdeavaygaavqagvlsg