PDB entry 6cyx

View 6cyx on RCSB PDB site
Description: Crystal structure analysis of the L80F mutant of Superoxide Dismutase from Trichoderma reesei
Class: oxidoreductase
Keywords: enzymatic activity, OXIDOREDUCTASE
Deposited on 2018-04-06, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6cyxa1, d6cyxa2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-End)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6cyxb1, d6cyxb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6cyxc1, d6cyxc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-End)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6cyxd1, d6cyxd2
  • Chain 'E':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6cyxe1, d6cyxe2
  • Chain 'F':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6cyxf1, d6cyxf2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyxA (A:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cyxB (B:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cyxB (B:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cyxC (C:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cyxC (C:)
    gtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsqia
    lqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgkal
    lgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayvdn
    iwkvinwktaeqrfkgdredafkilk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cyxD (D:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cyxD (D:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyxE (E:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyxF (F:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfnggghinhsffwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl