PDB entry 6cyv

View 6cyv on RCSB PDB site
Description: E. coli DHFR ternary complex with NADP and dihydrofolate
Class: oxidoreductase
Keywords: DHFR, dihydrofolate reductase, dihydrofolate, NADP, ternary complex, OXIDOREDUCTASE
Deposited on 2018-04-06, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: folA, c0058
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ5 (0-158)
      • expression tag (159-160)
    Domains in SCOPe 2.07: d6cyva1, d6cyva2
  • Heterogens: DHF, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cyvA (A:)
    misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cyvA (A:)
    misliaalavdrvipwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkniilssqp
    gtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthfp
    dyepddwesvfsefhdadaqnshsycfeilerrhh