PDB entry 6cyr

View 6cyr on RCSB PDB site
Description: Crystal structure of the UBE2A variant Q93E
Class: ligase, transferase
Keywords: Ubiquitin-Conjungating enzyme E2 A, Q93E variant, LIGASE, TRANSFERASE
Deposited on 2018-04-06, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 A
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2A, RAD6A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49459 (3-154)
      • expression tag (2)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d6cyra1, d6cyra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cyrA (A:)
    gshmstparrrlmrdfkrlqedppagvsgapsennimvwnavifgpegtpfedgtfklti
    efteeypnkpptvrfvskmfhpnvyadgsicldilenrwsptydvssiltsiqslldepn
    pnspansqaaqlyqenkreyekrvsaiveqswrdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cyrA (A:)
    hmstparrrlmrdfkrlqedppagvsgapsennimvwnavifgpegtpfedgtfkltief
    teeypnkpptvrfvskmfhpnvyadgsicldilenrwsptydvssiltsiqslldepnpn
    spansqaaqlyqenkreyekrvsaiveqswrdc