PDB entry 6cyp

View 6cyp on RCSB PDB site
Description: Crystal structure analysis of the H75I mutant of Superoxide Dismutase from Trichoderma reesei
Class: oxidoreductase
Keywords: enzymatic activity, OXIDOREDUCTASE
Deposited on 2018-04-06, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (73)
    Domains in SCOPe 2.08: d6cypa1, d6cypa2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (73)
    Domains in SCOPe 2.08: d6cypb1, d6cypb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (73)
    Domains in SCOPe 2.08: d6cypc1, d6cypc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (73)
    Domains in SCOPe 2.08: d6cypd1, d6cypd2
  • Chain 'E':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (73)
    Domains in SCOPe 2.08: d6cype1, d6cype2
  • Chain 'F':
    Compound: superoxide dismutase
    Species: Hypocrea jecorina (strain QM6a) [TaxId:431241]
    Gene: TRIREDRAFT_66345
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RQS7 (0-210)
      • engineered mutation (73)
    Domains in SCOPe 2.08: d6cypf1, d6cypf2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cypA (A:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfngggiinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cypB (B:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfngggiinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cypC (C:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfngggiinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cypD (D:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfngggiinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cypE (E:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfngggiinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cypF (F:)
    svgtfslpalpyaydalepsisaqimelhhskhhqtyvtnlnnalktystalaandvpsq
    ialqaaikfngggiinhslfwenlcpasspdadpasapeltaeiaktwgsldkfkeamgk
    allgiqgsgwgwlvkegsglrivttkdqdpvvggevpvfgidmwehayylqylngkaayv
    dniwkvinwktaeqrfkgdredafkilkasl