PDB entry 6cyi

View 6cyi on RCSB PDB site
Description: Grp94 N-domain bound to NEOCA
Class: Chaperone/Inhibitor
Keywords: HSP90, GRP94, Endoplasmic Reticulum, Chaperone, Inhibitor, Chaperone-Inhibitor complex
Deposited on 2018-04-05, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cyia_
  • Heterogens: N5O, PGE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cyiA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeeke
    dsddeaaveeeeeekkpktkkvektvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cyiA (A:)
    sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
    tvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseli
    gqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlk
    eeasdyleldtiknlvkkysqfinfpiyvwssktetkvektvwdwelmn