PDB entry 6cyf

View 6cyf on RCSB PDB site
Description: PcrV fragment with bound Fab
Class: immune system
Keywords: Part of type 3 secretion system in Pseudomonas aeruginosa, IMMUNE SYSTEM
Deposited on 2018-04-05, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type III secretion system protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pcrV
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4Q7H6 (10-126)
      • expression tag (1-9)
      • expression tag (127)
  • Chain 'B':
    Compound: Type III secretion system protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pcrV
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4Q7H6 (10-126)
      • expression tag (1-9)
  • Chain 'C':
    Compound: IgG1 antibody, kappa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-213)
    Domains in SCOPe 2.07: d6cyfc1, d6cyfc2
  • Chain 'D':
    Compound: IgG1 antibody, heavy chain fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (Start-226)
  • Chain 'E':
    Compound: IgG1 antibody, kappa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-213)
    Domains in SCOPe 2.07: d6cyfe1, d6cyfe2
  • Chain 'F':
    Compound: IgG1 antibody, heavy chain fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-End)
  • Chain 'I':
    Compound: Type III secretion system protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pcrV
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4Q7H6 (10-126)
      • expression tag (1-9)
      • expression tag (127)
  • Chain 'L':
    Compound: IgG1 antibody, kappa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-213)
    Domains in SCOPe 2.07: d6cyfl1, d6cyfl2
  • Chain 'M':
    Compound: IgG1 antibody, heavy chain fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-End)
  • Chain 'Q':
    Compound: Type III secretion system protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pcrV
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4Q7H6 (10-126)
      • expression tag (0-9)
  • Chain 'T':
    Compound: IgG1 antibody, kappa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-213)
    Domains in SCOPe 2.07: d6cyft1, d6cyft2
  • Chain 'U':
    Compound: IgG1 antibody, heavy chain fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CYF (0-226)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyfC (C:)
    aiqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapklliysastlqsgvps
    rfsgsgsgtdftltisslqpedfatyyclqdynypwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyfE (E:)
    aiqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapklliysastlqsgvps
    rfsgsgsgtdftltisslqpedfatyyclqdynypwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'F':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyfL (L:)
    aiqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapklliysastlqsgvps
    rfsgsgsgtdftltisslqpedfatyyclqdynypwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'M':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cyfT (T:)
    aiqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapklliysastlqsgvps
    rfsgsgsgtdftltisslqpedfatyyclqdynypwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'U':
    No sequence available.