PDB entry 6cy8

View 6cy8 on RCSB PDB site
Description: Crystal structure of FAD-dependent dehydrogenase
Class: biosynthetic protein
Keywords: acyl carrier protein, FAD-dependent enzyme, natural product biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2018-04-05, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha/beta hydrolase fold protein
    Species: Marinomonas mediterranea (strain ATCC 700492 / JCM 21426 / NBRC 103028 / MMB-1) [TaxId:717774]
    Gene: Marme_4088
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: butyryl-coa dehydrogenase
    Species: Marinomonas mediterranea (strain ATCC 700492 / JCM 21426 / NBRC 103028 / MMB-1) [TaxId:717774]
    Gene: Marme_4091
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cy8b1, d6cy8b2
  • Heterogens: FAD, PNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cy8B (B:)
    mnfewtheqaelfehalrfgkelsaplqedngfprdnwnalgdfgyfglpipekyakdgs
    gfdilttikiieglgqsctdtgllfagaahtfacsmpilehgsetlkhqllpdlatgrki
    aanaiseasagsdisnlattaqkegdyyvlnggksyvtngsiadyyvvyattnkkhgylg
    qtafvvprntpgisvgndyhklglrsaplnqvffdnctihkdyalgregqgarifaasmd
    wercclfaifvgamqrdlnqcieyantrmqgdktisrfqavshriadmgvrlesarlmly
    yaawqksqdvdntkavamsklaiseafvqsgidsirvhgalgyldegrvnnsikdalgsv
    lfsgtsdiqrelicnrlgll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cy8B (B:)
    mnfewtheqaelfehalrfgkelgfprdnwnalgdfgyfglpipekyakdgsgfdiltti
    kiieglgqsctdtgllfagaahtfacsmpilehgsetlkhqllpdlatkiaanaiseasa
    gsdisnlattaqkegdyyvlnggksyvtngsiadyyvvyattnkkhgylgqtafvvprnt
    pgisvgndyhklglrsaplnqvffdnctihkdyalgregqgarifaasmdwercclfaif
    vgamqrdlnqcieyantrmqgdktisrfqavshriadmgvrlesarlmlyyaawqksqdv
    dntkavamsklaiseafvqsgidsirvhgalgyldegrvnnsikdalgsvlfsgtsdiqr
    elicnrlgll