PDB entry 6cy7

View 6cy7 on RCSB PDB site
Description: Human Stimulator of Interferon Genes
Class: immune system
Keywords: human STING, complex, cyclic-di-AMP, TMEM173, Ala230 allelle, 230A/232R, IMMUNE SYSTEM
Deposited on 2018-04-04, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86WV6
      • conflict (91)
      • conflict (93)
    Domains in SCOPe 2.07: d6cy7a_
  • Heterogens: 2BA, IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cy7A (A:)
    lapaeisavcekgnfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrl
    yillpldcgvpdnlsmadpnirfldklpqqtadragikdrvysnsiyellengqragtcv
    leyatplqtlfamsqysqagfsredrleqaklfcrtlediladapesqnncrliayqepa
    ddssfslsqevlrhlrqeekeevtvgslktsavpststmsqepellisgmekplplrtdf
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cy7A (A:)
    nvahglawsyyigylrlilpelqarirtynqhavsqrlyillpldcgvpdnlsmadpnir
    fldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsqysqagfs
    redrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhlrqee