PDB entry 6cy6

View 6cy6 on RCSB PDB site
Description: Crystal structure of spermidine/spermine N-acetyltransferase SpeG from Escherichia coli in complex with tris(hydroxymethyl)aminomethane.
Class: transferase
Keywords: SpeG, spermidine, GNAT, N-acetyltransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2018-04-04, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: speG, b1584, JW1576
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cy6a_
  • Heterogens: CL, NA, TRS, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cy6A (A:)
    mpsahsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrf
    vvecdgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlykl
    ylivdkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaehktpgqtl
    lkptaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cy6A (A:)
    hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
    dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
    dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaeh