PDB entry 6cxy

View 6cxy on RCSB PDB site
Description: Crystal Structure of Human E-cadherin bound by mouse monoclonal antibody Fab mAb-1_19A11
Class: cell adhesion
Keywords: SSGCID, Cadherin-1, cell adhesion, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-04-04, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Cadherin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 6CXY (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Gene: LC
    Database cross-references and differences (RAF-indexed):
    • PDB 6CXY (0-End)
    Domains in SCOPe 2.07: d6cxyl1, d6cxyl2
  • Heterogens: CA, EDO, PG4, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6cxyL (L:)
    divmtqspsslamsvgqkvtmnckssqsllnssnqknylawyqqkpgqspklliyftstr
    gsgvpdrfigsgsgtdftltissveaedladyfcqqhyrtphtfgggtkveikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxyL (L:)
    divmtqspsslamsvgqkvtmnckssqsllnssnqknylawyqqkpgqspklliyftstr
    gsgvpdrfigsgsgtdftltissveaedladyfcqqhyrtphtfgggtkveikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr