PDB entry 6cxw

View 6cxw on RCSB PDB site
Description: Synaptotagmin 1 C2A beta4 chimera with enhanced PIP2 binding function
Class: exocytosis
Keywords: C2 domain, EXOCYTOSIS
Deposited on 2018-04-04, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin 1 C2A beta4 chimera
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Syt1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21707 (Start-42)
      • linker (43-62)
    • Uniprot P21707 (63-127)
    Domains in SCOPe 2.07: d6cxwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cxwA (A:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkihlmqngkrlkkkktti
    kkntlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvte
    ewrdlqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxwA (A:)
    klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkihlmqngkrlkkkkttik
    kntlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvtee
    wrdlqsa