PDB entry 6cxv

View 6cxv on RCSB PDB site
Description: Structure of the S167H mutant of human indoleamine 2,3 dioxygenase in complex with tryptophan and cyanide
Class: oxidoreductase
Keywords: Heme, dioxygenase, Tryptophan, IDO, OXIDOREDUCTASE
Deposited on 2018-04-04, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (Start-392)
      • engineered mutation (156)
    Domains in SCOPe 2.07: d6cxva_
  • Chain 'B':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902
      • engineered mutation (156)
    Domains in SCOPe 2.07: d6cxvb_
  • Heterogens: HEM, CYN, TRP, ZCW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cxvA (A:)
    mskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsed
    pskleakgtggtdlmnflktvrstteksllkegkgelnsklegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxvA (A:)
    yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
    sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvlanw
    kkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqmqerd
    tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
    dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
    svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpleakgtggtdlm
    nflktvrstteksllkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cxvB (B:)
    mskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsed
    pskleakgtggtdlmnflktvrstteksllkegkgelnsklegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxvB (B:)
    yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
    sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvlanw
    kkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqmqerd
    tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
    dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
    svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpleakgtggtdlm
    nflktvrstteksllke