PDB entry 6cxu

View 6cxu on RCSB PDB site
Description: Structure of the S167H mutant of human indoleamine 2,3 dioxygenase in complex with tryptophan and cyanide
Class: oxidoreductase
Keywords: Heme, dioxygenase, Tryptophan, IDO, OXIDOREDUCTASE
Deposited on 2018-04-04, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (1-392)
      • engineered mutation (156)
    Domains in SCOPe 2.07: d6cxua_
  • Chain 'B':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (1-392)
      • engineered mutation (156)
    Domains in SCOPe 2.07: d6cxub_
  • Heterogens: HEM, CYN, TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cxuA (A:)
    mskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsed
    pskleakgtggtdlmnflktvrstteksllkegkgelnsklegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxuA (A:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
    snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpleakgtggt
    dlmnflktvrstteksllkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cxuB (B:)
    mskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsed
    pskleakgtggtdlmnflktvrstteksllkegkgelnsklegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxuB (B:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvhllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
    snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpakgtggtdl
    mnflktvrstteksllkeg