PDB entry 6cxm

View 6cxm on RCSB PDB site
Description: Crystal structure of a dihydrofolate reductase from Mycobacterium smegmatis in complex with NADP and P218
Class: oxidoreductase/inhibitor
Keywords: NIAID, National Institute of Allergy and Infectious Disease, structural genomics, Mycobacterium tuberculosis, Mtb, inhibitor, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE-INHIBITOR complex
Deposited on 2018-04-03, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: folA, MSMEI_2607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cxma_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: folA, MSMEI_2607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cxmb_
  • Heterogens: NAP, MMV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cxmA (A:)
    mahhhhhhmsmrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslp
    asvrplpgrrnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevte
    vdialtpldgdarapvlddswvattgewqtstsglrfrfcsyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxmA (A:)
    smrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslpasvrplpgr
    rnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevtevdialtpld
    gdarapvlddswvattgewqtstsglrfrfcsyrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cxmB (B:)
    mahhhhhhmsmrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslp
    asvrplpgrrnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevte
    vdialtpldgdarapvlddswvattgewqtstsglrfrfcsyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cxmB (B:)
    smrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslpasvrplpgr
    rnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevtevdialtpld
    gdarapvlddswvattgewqtstsglrfrfcsyrr