PDB entry 6cx2

View 6cx2 on RCSB PDB site
Description: S177G Mutant of Yeast PCNA
Class: DNA binding protein
Keywords: DNA Replication, DNA Repair, DNA Recombination, Scaffold, DNA BINDING PROTEIN
Deposited on 2018-04-02, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (1-End)
      • engineered mutation (177)
    Domains in SCOPe 2.07: d6cx2a1, d6cx2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cx2A (A:)
    hmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqe
    yrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklm
    didadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigggs
    viikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqf
    dlksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cx2A (A:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigggsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkf