PDB entry 6cww

View 6cww on RCSB PDB site
Description: Cs H-NOX mutant with unnatural amino acid 4-cyano-L-phenylalanine at site 5
Class: oxygen binding
Keywords: HNOX, unnatural amino acid, nonnatural amino acid, gas binding, OXYGEN BINDING
Deposited on 2018-03-31, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus [TaxId:911092]
    Gene: XD49_1849
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A117KVF3 (0-End)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d6cwwa_
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus [TaxId:911092]
    Gene: XD49_1849
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A117KVF3 (0-End)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d6cwwb_
  • Heterogens: 211, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cwwA (A:)
    mkgtxvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykknenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwwA (A:)
    mkgtxvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cwwB (B:)
    mkgtxvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykknenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwwB (B:)
    mkgtxvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfey