PDB entry 6cwk

View 6cwk on RCSB PDB site
Description: Anti-RTA VHH antibody
Class: immune system
Keywords: Ricin binding antibody, IMMUNE SYSTEM
Deposited on 2018-03-30, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-Ricin antibody
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CWK (0-End)
    Domains in SCOPe 2.07: d6cwka_
  • Heterogens: SO4, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cwkA (A:)
    qvqlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggt
    yyadsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwg
    qgtqvtvssepktpkpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cwkA (A:)
    qvqlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggt
    yyadsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwg
    qgtqvtvss