PDB entry 6cw5

View 6cw5 on RCSB PDB site
Description: Crystal structure of Ribokinase from Cryptococcus neoformans var. grubii serotype A
Class: transferase
Keywords: SSGCID, Cryptococcus neoformans, Ribokinase, phosphorylation, ATP, ADP, D-ribose, D-ribose 5-phosphate, structural genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2018-03-29, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribokinase
    Species: Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) [TaxId:235443]
    Gene: CNAG_02296
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cw5a_
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cw5A (A:)
    mahhhhhhmstssrclvrgsvnideffhlphivrpgetisstgltkraggkganqafava
    raggqveldgaigddgiwvkemlesagvgtdklkivkdevtgraviqsaadgensivlha
    ganyylpsptpttslatythllvqnevplsstlayltaagqssppltsvfnpspmltpaq
    lrefpwkhlswlivnegelgdlllafgssanpgeakedelqakasagilelhendyfskn
    vgiictlgakgilcyepgkevgylpaaklqnpvkdttgagdcfagyfvaglmsgkslqda
    lktclvacgicvenegamesvptlnavkerla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cw5A (A:)
    ssrclvrgsvnideffhlphivrpgetisstgltkraggkganqafavaraggqveldga
    igddgiwvkemlesagvgtdklkivkdevtgraviqsaadgensivlhaganyylpsptp
    ttslatythllvqnevplsstlayltaagqssppltsvfnpspmltpaqlrefpwkhlsw
    livnegelgdlllafgssanpgeakedelqakasagilelhendyfsknvgiictlgakg
    ilcyepgkevgylpaaklqnpvkdttgagdcfagyfvaglmsgkslqdalktclvacgic
    venegamesvptln