PDB entry 6cw4

View 6cw4 on RCSB PDB site
Description: HADDOCK structure of the Rous sarcoma virus matrix protein (M-domain) in complex with inositol 1,3,5-trisphosphate
Class: viral protein
Keywords: RSV, ASV, Gag, I(1, 3, 5)P3, VIRAL PROTEIN
Deposited on 2018-03-29, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix protein p19
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (0-86)
      • engineered mutation (0)
    Domains in SCOPe 2.08: d6cw4a_
  • Heterogens: FGV

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cw4A (A:)
    seavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
    ramilgksgelktwglvlgalkaaree