PDB entry 6cvx

View 6cvx on RCSB PDB site
Description: Crystal structure of HCV NS3/4A WT protease in complex with AJ-50 (MK-5172 linear analogue)
Class: HYDROLASE/HYDROLASE Inhibitor
Keywords: NS3/4a Protease, Hepatitis C virus, Drug Resistance, protease inhibitor, HYDROLASE-HYDROLASE Inhibitor complex
Deposited on 2018-03-29, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease
    Species: Hepacivirus C [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B4WYC6 (24-End)
      • expression tag (0-23)
      • conflict (33-34)
      • conflict (37-38)
      • conflict (41)
      • conflict (67)
      • conflict (72)
      • conflict (92)
      • conflict (106)
    Domains in SCOPe 2.08: d6cvxa1, d6cvxa2
  • Heterogens: FH4, SO4, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cvxA (A:)
    gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
    tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
    gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavc
    trgvakavdfipveslettmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cvxA (A:)
    gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
    tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
    gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavc
    trgvakavdfipveslettm