PDB entry 6cvb

View 6cvb on RCSB PDB site
Description: CryoEM structure of human enterovirus D68 in complex with 6'-sialyl-N-acetyllactosamine
Class: virus
Keywords: virus, genome release, receptor
Deposited on 2018-03-27, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: EM
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral protein 1
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cvba_
  • Chain 'B':
    Compound: viral protein 3
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cvbb_
  • Chain 'C':
    Compound: viral protein 2
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: viral protein 4
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 4U1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cvbA (A:)
    iesiiktatdtvkseinaelgvvpslnavetgatsntepeeaiqtrtvinqhgvsetlve
    nflsraalvskrsfeykdhtssaaqtdknffkwtintrsfvqlrrklelftylrfdaeit
    ilttvavngssnntymglpnltlqamfvptgaltpekqdsfhwqsgsnasvffkisdppa
    rmtipfmcinsaysvfydgfagfeksglyginpadtignlcvrivnehqpvgftvtvrvy
    mkpkhikawaprpprtlpymsiananykgkkrapnalnaiignrdsvktmphnivtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cvbA (A:)
    iesiiktatdtvkseinaelgvvslnavetgatsntepeeaiqtrtvinqhgvsetlven
    flsraalvskrsfeykdhtssaaqtdknffkwtintrsfvqlrrklelftylrfdaeiti
    lttvavntymglpnltlqamfvptgaltpekqdsfhwqsgsnasvffkisdpparmtipf
    mcinsaysvfydgfagfeksglyginpadtignlcvrivnehqpvgftvtvrvymkpkhi
    kawaprpprtlpymsiananykgkkrapnalnaiignrdsvktmphnivt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvbB (B:)
    gvptyllpgsgqflttddhssapvlpcfnptpemhipgqvrnmlevvqvesmmeinntes
    avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
    gsfmatgklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyrmfnn
    dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqidhlh
    aaeaayq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.