PDB entry 6cva

View 6cva on RCSB PDB site
Description: Crystal structure of the N. meningitides methionine-binding protein in its substrate-free conformation
Class: protein binding
Keywords: substrate-binding protein, PROTEIN BINDING
Deposited on 2018-03-27, released 2019-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Neisseria meningitidis [TaxId:487]
    Gene: gna1946, A6J54_04155, A6L27_04980, CWI43_07600, CWI45_01195, CWI46_00955, CWI48_04325, CWI52_00775, CWI53_02070, CWI56_11320, CWI58_01890, CWI60_00490, ERS514410_01419, ERS514851_01229
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JPG4 (0-240)
      • conflict (194)
    Domains in SCOPe 2.08: d6cvaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cvaA (A:)
    eivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkpy
    lddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmlde
    lgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgmk
    ltealfqepsfayvawsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawne
    g