PDB entry 6cuq

View 6cuq on RCSB PDB site
Description: Crystal structure of Macrophage migration inhibitory factor-like protein (EhMIF) from Entamoeba histolytica
Class: cytokine
Keywords: SSGCID, Structural genomics, Seattle Structural Genomics Center for Infectious Disease, CYTOKINE
Deposited on 2018-03-26, released 2018-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.4499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_092370
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LV00 (8-120)
      • expression tag (7)
    Domains in SCOPe 2.08: d6cuqa1, d6cuqa2
  • Chain 'B':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_092370
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LV00 (8-120)
      • expression tag (4-7)
    Domains in SCOPe 2.08: d6cuqb1, d6cuqb2
  • Chain 'C':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_092370
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LV00 (8-120)
      • expression tag (6-7)
    Domains in SCOPe 2.08: d6cuqc1, d6cuqc2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cuqA (A:)
    mahhhhhhmphalitlsaditeeikkeiahesmkilsevigkpisycatqvvtsvggfgg
    kivksafidiksisglkgkqeglsdrycklleqkagieggniylnftemtgnnwgydhst
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cuqA (A:)
    hmphalitlsaditeeikkeiahesmkilsevigkpisycatqvvtsvggfggkivksaf
    idiksisglkgkqeglsdrycklleqkagieggniylnftemtgnnwgydhstf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cuqB (B:)
    mahhhhhhmphalitlsaditeeikkeiahesmkilsevigkpisycatqvvtsvggfgg
    kivksafidiksisglkgkqeglsdrycklleqkagieggniylnftemtgnnwgydhst
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cuqB (B:)
    hhhhmphalitlsaditeeikkeiahesmkilsevigkpisycatqvvtsvggfggkivk
    safidiksisglkgkqeglsdrycklleqkagieggniylnftemtgnnwgydhstf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cuqC (C:)
    mahhhhhhmphalitlsaditeeikkeiahesmkilsevigkpisycatqvvtsvggfgg
    kivksafidiksisglkgkqeglsdrycklleqkagieggniylnftemtgnnwgydhst
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cuqC (C:)
    hhmphalitlsaditeeikkeiahesmkilsevigkpisycatqvvtsvggfggkivksa
    fidiksisglkgkqeglsdrycklleqkagieggniylnftemtgnnwgydhstf