PDB entry 6cuh

View 6cuh on RCSB PDB site
Description: Crystal structure of the unliganded BC8B TCR
Class: immune system
Keywords: T cell receptor, TCR, BC8B, CD1b, PC, phosphatidylcholine, IMMUNE SYSTEM
Deposited on 2018-03-26, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell Receptor alpha variable, TRAV 9-2. BC8B TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CUH
    Domains in SCOPe 2.07: d6cuha1, d6cuha2
  • Chain 'B':
    Compound: T-cell Receptor beta variable, TRBV 6-2. BC8B TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CUH
    Domains in SCOPe 2.07: d6cuhb1, d6cuhb2
  • Heterogens: PEG, PO4, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cuhA (A:)
    gnsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnk
    gfeatyrkettsfhlekgsvqvsdsavyfcaltpsggyqkvtfgtgtklqvipniqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cuhA (A:)
    nsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkg
    featyrkettsfhlekgsvqvsdsavyfcaltpsggyqkvtfgtgtklqvipniqnpdpa
    vyqlrdsksdksvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cuhB (B:)
    nagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgev
    pdgynvsrlkkqnfllglesaapsqtsvyfcassmpglrssyeqyfgpgtrltvtedlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cuhB (B:)
    agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
    dgynvsrlkkqnfllglesaapsqtsvyfcassmpgsyeqyfgpgtrltvtedlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra