PDB entry 6cu6

View 6cu6 on RCSB PDB site
Description: Crystal structure of GMPPNP-bound G12R mutant of human KRAS4b
Class: oncoprotein
Keywords: KRAS, RAS, G12R, G12, KRAS4b, K-RAS, ONCOPROTEIN
Deposited on 2018-03-23, released 2019-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6cu6a1, d6cu6a2
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6cu6b1, d6cu6b2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6cu6c1, d6cu6c2
  • Heterogens: GNP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cu6A (A:)
    gmteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cu6A (A:)
    gmteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlp
    srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cu6B (B:)
    gmteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cu6B (B:)
    gmteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    geeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cu6C (C:)
    gmteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cu6C (C:)
    gmteyklvvvgargvgksaltiqliqnhfvdsyrkqvvidgetclldildtaqymrtgeg
    flcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsy
    gipfietsaktrqgvddafytlvreirkhke