PDB entry 6cu5

View 6cu5 on RCSB PDB site
Description: Crystal structure of a protein arginine N-methyltransferase from Naegleria fowleri bound to SAH
Class: transferase
Keywords: NIAID, structural genomics, brain eating amoeba, Primary Amebic Meningoencephalitis (PAM), Amebic Encephalitis, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2018-03-23, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein arginine N-methyltransferase
    Species: Naegleria fowleri [TaxId:5763]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CU5 (Start-335)
    Domains in SCOPe 2.07: d6cu5a_
  • Chain 'B':
    Compound: protein arginine N-methyltransferase
    Species: Naegleria fowleri [TaxId:5763]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CU5 (Start-335)
    Domains in SCOPe 2.07: d6cu5b_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cu5A (A:)
    mahhhhhhmndfhhdfqqqqpttgiheemlkdgirtnayknailqnkhlfkdkvvldigc
    gtgilclfaakagakrvigidmsdiidkarqivsdngyshvielikgkvediaqlpfgie
    kvdiiisewmgyfllyesmlqtvlsardrwlrpggylfpdkctmyicgiedseykrdkid
    fwdnvygfnfsaikadalreplvdfvesqqiittqskfleidlntiqpedlkqittsfef
    tsqyqeycqafvawfdcvfsrgphkpvefstgpftegthwkqtvfylendlplkpndvik
    gtitisqnksnhrdldismkytvnggavisqdyimr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cu5A (A:)
    tgiheemlkdgirtnayknailqnkhlfkdkvvldigcgtgilclfaakagakrvigidm
    sdiidkarqivsdngyshvielikgkvediaqlpfgiekvdiiisewmgyfllyesmlqt
    vlsardrwlrpggylfpdkctmyicgiedseykrdkidfwdnvygfnfsaikadalrepl
    vdfvesqqiittqskfleidlntiqpedlkqittsfeftsqyqeycqafvawfdcvfsrg
    phkpvefstgpftegthwkqtvfylendlplkpndvikgtitisqnksnhrdldismkyt
    vnggavisqdyimr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cu5B (B:)
    mahhhhhhmndfhhdfqqqqpttgiheemlkdgirtnayknailqnkhlfkdkvvldigc
    gtgilclfaakagakrvigidmsdiidkarqivsdngyshvielikgkvediaqlpfgie
    kvdiiisewmgyfllyesmlqtvlsardrwlrpggylfpdkctmyicgiedseykrdkid
    fwdnvygfnfsaikadalreplvdfvesqqiittqskfleidlntiqpedlkqittsfef
    tsqyqeycqafvawfdcvfsrgphkpvefstgpftegthwkqtvfylendlplkpndvik
    gtitisqnksnhrdldismkytvnggavisqdyimr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cu5B (B:)
    giheemlkdgirtnayknailqnkhlfkdkvvldigcgtgilclfaakagakrvigidms
    diidkarqivsdngyshvielikgkvediaqlpfgiekvdiiisewmgyfllyesmlqtv
    lsardrwlrpggylfpdkctmyicgiedseykrdkidfwdnvygfnfsaikadalreplv
    dfvesqqiittqskfleidlntiqpedlkqittsfeftsqyqeycqafvawfdcvfsrgp
    hkpvefstgpftegthwkqtvfylendlplkpndvikgtitisqnksnhrdldismkytv
    nggavisqdyimr