PDB entry 6cth

View 6cth on RCSB PDB site
Description: Crystal Structure of Pathogenesis-related Protein 1G (PR-1G) Kinase Domain from Cacao
Class: transferase/transferase inhibitor
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Transferase-Transferase Inhibitor complex
Deposited on 2018-03-23, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin A-like lectin protein kinase family protein
    Species: Theobroma cacao [TaxId:3641]
    Gene: TCM_042446
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ctha1, d6ctha2
  • Heterogens: FE7, MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cthA (A:)
    smrkfslnelakvtsnfnaenklgeggfgsvyrgflrdsdtyiavkkvsraskqgikeya
    sevkiisrlrhknlvkligwchergelmlvyefmangsldshifkgkslltwevryrivk
    dlasallylheegdhcvlhrdiktsnimldssfnaklgdfglarlvdhakglkktllagt
    vgymapeclssgkaskesdvysfgvvaleiasgrrsiepkfeesealllvpwvwesygne
    rildiadrklgmafdpkqleclvmvglwcahpshnlrpsirqviqvlnfeaplpnlpgsm
    pipnyndvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cthA (A:)
    mrkfslnelakvtsnfnaenklgeggfgsvyrgflrdsdtyiavkkvsraskqgikeyas
    evkiisrlrhknlvkligwchergelmlvyefmangsldshifkgkslltwevryrivkd
    lasallylheegdhcvlhrdiktsnimldssfnaklgdfglarlvdktllagtvgymape
    clssgkaskesdvysfgvvaleiasgrrsiepkfeesealllvpwvwesygnerildiad
    rklgmafdpkqleclvmvglwcahpshnlrpsirqviqvlnfeaplpnlpgsmpi