PDB entry 6ctc

View 6ctc on RCSB PDB site
Description: Crystal structure of human transferrin bound to Triferic FPC iron pyrophosphate
Class: metal transport
Keywords: iron, pyrophosphate, transferrin, triferic iron, FPC, transfusion, blood, plasma, METAL TRANSPORT
Deposited on 2018-03-22, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serotransferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: TF, PRO1400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ctca1, d6ctca2
  • Heterogens: FE, CO3, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ctcA (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptdeckpvkwcalshherlkcdewsv
    nsvgkiecvsaettedciakimngeadamsldggfvyiagkcglvpvlaenynksdnced
    tpeagyfaiavvkksasdltwdnlkgkkschtavgrtagwnipmgllynkinhcrfdeff
    segcapgskkdsslcklcmgsglnlcepnnkegyygytgafrclvekgdvafvkhqtvpq
    ntggknpdpwaknlnekdyellcldgtrkpveeyanchlarapnhavvtrkdkeacvhki
    lrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvclaklhdrntyekylgeeyvkavg
    nlrkcstsslleactfrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ctcA (A:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtcpeeckpvkwcalshherlkcdewsvnsvgki
    ecvsaettedciakimngeadamsldggfvyiagkcglvpvlaenynksdncedtpeagy
    faiavvkksasdltwdnlkgkkschtavgrtagwnipmgllynkinhcrfdeffsegcap
    gskkdsslcklcmgsglnlcepnnkegyygytgafrclvekgdvafvkhqtvpqntggkn
    pdpwaknlnekdyellcldgtrkpveeyanchlarapnhavvtrkdkeacvhkilrqqqh
    lfgsnvtdcsgnfclfrsetkdllfrddtvclaklhdrntyekylgeeyvkavgnlrkcs
    tsslleactfrrp