PDB entry 6ct2

View 6ct2 on RCSB PDB site
Description: MYST histone acetyltransferase KAT6A/B in complex with WM-1119
Class: transferase/inhibitor
Keywords: complex, lysine acetyltransferases, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2018-03-22, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT8, MOF, MYST1, PP7073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7Z6 (Start-294)
      • conflict (94)
      • conflict (160)
      • conflict (163-164)
      • conflict (175)
      • conflict (217)
    Domains in SCOPe 2.08: d6ct2a_
  • Heterogens: FCV, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ct2A (A:)
    mgsshhhhhhssglvprgstkvkyvdkihignyeidawyfspfpedygkqpklwlceycl
    kymkyeksyrfhlgqcqwrqppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhk
    tlyfdvepfvfyiltevdrqgahivgyfskekespdgnnvscimilppyqrrgygrflia
    fsyelsklestvgspekplsdlgklsyrsywswvllenlrdfrgtlsikdlsqmtsitqn
    diistlqslnmvkywkgqhvicvtpklveehlksaqykkppitvdsvclkwappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ct2A (A:)
    vkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqp
    pgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqg
    ahivgyfskekespdgnnvscimilppyqrrgygrfliafsyelsklestvgspekplsd
    lgklsyrsywswvllenlrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvi
    cvtpklveehlksaqykkppitvdsvclkwappk