PDB entry 6csy

View 6csy on RCSB PDB site
Description: Crystal structure of human beta2 adrenergic receptor bound to salmeterol and Nb71
Class: signaling protein
Keywords: G protein-coupled receptor, adrenergic receptor, asthma drug, active, nanobody, SIGNALING PROTEIN
Deposited on 2018-03-21, released 2018-10-24
Made obsolete by 6mxt on 2018-11-14

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion protein of Lysozyme and Beta-2 adrenergic receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ADRB2, ADRB2R, B2AR
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9IEF7 (1-160)
      • expression tag (0)
      • engineered mutation (53)
      • engineered mutation (96)
      • linker (161-162)
    • Uniprot P07550 (163-End)
      • engineered mutation (230)
      • engineered mutation (232)
      • engineered mutation (321)
  • Chain 'N':
    Compound: Single chain antibody (nanobody)
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CSY (0-121)
    Domains in SCOPe 2.07: d6csyn1, d6csyn2, d6csyn3
  • Heterogens: F9S, MG, NI, OLC, HTO, OLA, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csyN (N:)
    qvqlqesggglvqpggslrlscaasgfafssyelrwyrqapgkqhelvagittggntyya
    dsvkgrftisrdnakntvylqmsnlrpedtavyacnanwdllsdywgqgtqvtvsshhhh
    hh