PDB entry 6csj

View 6csj on RCSB PDB site
Description: Structure of a Bacillus coagulans polyol dehydrogenase double mutant with an acquired D-lactate dehydrogenase activity
Class: oxidoreductase
Keywords: polyol dehydrogenase, OXIDOREDUCTASE
Deposited on 2018-03-20, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csja_
  • Chain 'B':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csjb_
  • Chain 'C':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csjc_
  • Chain 'D':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csjd_
  • Chain 'E':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csje_
  • Chain 'F':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csjf_
  • Chain 'G':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csjg_
  • Chain 'H':
    Compound: glycerol dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A150JSL8 (0-365)
      • engineered mutation (120)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d6csjh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjA (A:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjB (B:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjC (C:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjD (D:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjE (E:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjF (F:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjG (G:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6csjH (H:)
    mtkiitspskfiqgpdelsrlsayterlgkkafiiaddfvtglvgktveesyagketgyq
    malfggecskpeierlcemskseeadvvvgigggktldtakavgyynnipvivaptiast
    naptsalsviykengefeeylmlplnptfvimdtkviasaparllvsgmgdalatyfear
    atkrankttmaggrvteaaialaklcydtqileglkaklaaekhlvteavekiieantyl
    sgigsesgglaaahaihngltvleethhmyhgekvafgtlaqliledapkaeieevvsfc
    lsvglpvtlgdlgvkelneeklrkvaelscaegetiynmpfevtpdlvyaaivtadsvgr
    yykekw