PDB entry 6cs9

View 6cs9 on RCSB PDB site
Description: Crystal structure of human beta-defensin 2 in complex with PIP2
Class: antimicrobial protein
Keywords: antimicrobial, antifungal, defensin, innate defense, ANTIMICROBIAL PROTEIN
Deposited on 2018-03-20, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-defensin 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: DEFB4A, DEFB102, DEFB2, DEFB4, DEFB4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cs9a_
  • Chain 'B':
    Compound: Beta-defensin 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: DEFB4A, DEFB102, DEFB2, DEFB4, DEFB4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cs9b_
  • Heterogens: PIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cs9A (A:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cs9B (B:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp