PDB entry 6cro

View 6cro on RCSB PDB site
Description: crystal structure of lambda-cro bound to a consensus operator at 3.0 angstrom resolution
Class: gene regulation/DNA
Keywords: complex (transcription regulation/DNA), cro, bacteriophage lambda, conformational change, repressor, helix-turn-helix
Deposited on 1998-04-22, released 1998-09-16
The last revision prior to the SCOP 1.73 freeze date was dated 1998-09-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.194
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda cro repressor
    Species: Bacteriophage lambda
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d6croa_
  • Chain 'R':
    Compound: DNA (5'-d(*ap*cp*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*ap*c)-3')
  • Chain 'U':
    Compound: DNA (5'-d(*tp*gp*tp*ap*tp*cp*ap*cp*cp*cp*gp*cp*gp*gp*tp*gp*ap*tp*ap*g)-3')
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6croA (A:)
    eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsn
    

  • Chain 'R':
    No sequence available.

  • Chain 'U':
    No sequence available.