PDB entry 6cro

View 6cro on RCSB PDB site
Description: crystal structure of lambda-cro bound to a consensus operator at 3.0 angstrom resolution
Deposited on 1998-04-22, released 1998-09-16
The last revision prior to the SCOP 1.71 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.194
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d6croa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6croA (A:)
    eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsn