PDB entry 6crn

View 6crn on RCSB PDB site
Description: Structure of the USP15 deubiquitinase domain in complex with a high-affinity first-generation Ubv
Class: signaling protein
Keywords: deubiuqitination, Ubv, high-affinity, inhibition, SIGNALING PROTEIN
Deposited on 2018-03-19, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4E8 (Start-200)
    • Uniprot Q9Y4E8 (201-354)
      • expression tag (355-356)
    Domains in SCOPe 2.07: d6crna1, d6crna2
  • Chain 'B':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6crnb_
  • Chain 'C':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6crnc_
  • Chain 'D':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4E8 (Start-200)
    • Uniprot Q9Y4E8 (201-354)
      • expression tag (355-356)
    Domains in SCOPe 2.07: d6crnd1, d6crnd2
  • Chain 'E':
    Compound: Ubiquitin variant 15.2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 6CRN (0-End)
    Domains in SCOPe 2.07: d6crne_
  • Chain 'F':
    Compound: Ubiquitin variant 15.2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 6CRN
    Domains in SCOPe 2.07: d6crnf_
  • Chain 'G':
    Compound: Ubiquitin variant 15.2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 6CRN
    Domains in SCOPe 2.07: d6crng_
  • Chain 'H':
    Compound: Ubiquitin variant 15.2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 6CRN
    Domains in SCOPe 2.07: d6crnh_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6crnA (A:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynlia
    vsnhyggmggghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssgzn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnA (A:)
    grnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrgeia
    ksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellaflldglhedlnri
    rkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfd
    pfcyltlplpmpkkpfvklkdcielfttkeklpwycpnckehqqatkkldlwslppvlvv
    hlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynliavsnhyggmggghyt
    afaknkddgkwyyfddssvstasedqivskaayvlfyqrqdss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6crnB (B:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynlia
    vsnhyggmggghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssgzn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnB (B:)
    sepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrg
    eiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgcqellaflldglhedlnrirk
    kpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfdpf
    cyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlwslppvl
    vvhlkrfsdkldtlvdfpindldmseflinpnagpcrynliavsnhygghytafaknkdd
    gkwyyfddssvstasedqivskaayvlfyqrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6crnC (C:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynlia
    vsnhyggmggghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssgzn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnC (C:)
    sepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrg
    eiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqcqellaflldglhedlnri
    rkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfd
    pfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlwslpp
    vlvvhlkrfkldtlvdfpindldmseflinpnagpcrynliavsnhygggghytafaknk
    ddgkwyyfddssvstasedqivskaayvlfyqrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6crnD (D:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynlia
    vsnhyggmggghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssgzn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnD (D:)
    grnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrgeia
    ksyaelikqmwsgkfsyvtprafktqvgrfapqfsqqqdcqellaflldglhedlnrirk
    kpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfdpf
    cyltlplpmpkkpfvklkdcielfttkekledpwycpnckehqqatkkldlwslppvlvv
    hlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynliavsnhyggmggghyt
    afaknkddgkwyyfddssvstasedqivskaayvlfyqrqdss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6crnE (E:)
    gaamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtls
    dyniqkystlhlllrlrgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnE (E:)
    gaamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtls
    dyniqkystlhlll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6crnF (F:)
    gaamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtls
    dyniqkystlhlllrlrgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnF (F:)
    aamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtlsd
    yniqkystlhlllr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6crnG (G:)
    gaamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtls
    dyniqkystlhlllrlrgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnG (G:)
    aamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtlsd
    yniqkystlhll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6crnH (H:)
    gaamqifvktlaskfislevepsdtienvkakiqdkegippdqqtlifarkqledgrtls
    dyniqkystlhlllrlrgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crnH (H:)
    aamqifvktlaislevepsdtienvkakiqdkegippdtlifarkqledgrtlsdyniqk
    ystlhlllr