PDB entry 6crg

View 6crg on RCSB PDB site
Description: Crystal Structure of Shp2 E76K GOF Mutant in complex with SHP099
Class: hydrolase/hydrolase inhibitor
Keywords: SHP2, PTPN11, PROTEIN TYROSINE PHOSPHATASE, E76K, Gain of Function Mutant, ALLOSTERIC INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR COMPLEX, PHOSPHATASE
Deposited on 2018-03-17, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-525)
      • engineered mutation (76)
    Domains in SCOPe 2.08: d6crga1, d6crga2, d6crga3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-525)
      • engineered mutation (76)
    Domains in SCOPe 2.08: d6crgb1, d6crgb2, d6crgb3
  • Heterogens: 5OD, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6crgA (A:)
    gmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaklvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crgA (A:)
    rrwfhpnitgveaenllltrgvdgsflarpsdftlsvrrngavthikiqntgdyydlygg
    ekfatlaklvqyymehvielkyplncadptserwfhghlsgkeaeklltekgkhgsflvr
    esqshpgdfvlsvrtgsndgkskvthvmircqelkydvgggerfdsltdlvehykknpmv
    etlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqe
    nknknryknilpfdhtrvvlhdgpvsdyinaniimpksyiatqgclqntvndfwrmvfqe
    nsrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgq
    gntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgt
    fividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6crgB (B:)
    gmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaklvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6crgB (B:)
    rrwfhpnitgveaenllltgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyyd
    lkfatlaklvqyymehvielkyplncadptserwfhghlsgkeaeklltekgkhgsflvr
    esqshpgdfvlsvrtgndgkskvthvmircqelkydvgggerfdsltdlvehykknpmve
    tlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqen
    knknryknilpfdhtrvvlhvsdyinaniimpksyiatqgclqntvndfwrmvfqensrv
    ivmttkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtw
    pdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekg
    vdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl