PDB entry 6cqv

View 6cqv on RCSB PDB site
Description: Crystal Structure of Recombinant Human Acetylcholinesterase in Complex with VX(+) and HI-6
Class: hydrolase
Keywords: Hydrolase
Deposited on 2018-03-16, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqva_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqvb_
  • Heterogens: HI6, FUC, NAG, VX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cqvA (A:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqvA (A:)
    redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
    ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
    fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
    vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
    earrratqlahlvgcpptggndtelvaclrtrpaqvlvnhewhvlpesvfrfsfvpvvdg
    dflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrv
    gvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarv
    yayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfar
    tgdpneapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cqvB (B:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqvB (B:)
    redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
    ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
    fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
    vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
    earrratqlahlvgcppndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdf
    lsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgv
    pqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvya
    yvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartg
    dpneapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa