PDB entry 6cqg

View 6cqg on RCSB PDB site
Description: YycF Effector Domain Structure without DNA bound
Class: DNA binding protein
Keywords: DNA-Binding-Protein, Two-Component-System, Effector-Domain, Winged-helix-turn-helix-DNA-binding domain, DNA BINDING PROTEIN
Deposited on 2018-03-15, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: yycF, ERS021524_01324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cqga_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cqgA (A:)
    piqigdleivpdayvakkygeeldlthrefellyhlashtgqvitrehlletvwgydyfg
    dvrtvdvtvrrlrekiedtpsrpeyiltrrgvgyymrn