PDB entry 6cqf

View 6cqf on RCSB PDB site
Description: Crystal structure of HPK1 in complex an inhibitor G1858
Class: transferase/transferase inhibitor
Keywords: Protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-03-15, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitogen-activated protein kinase kinase kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP4K1, HPK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92918 (Start-293)
      • conflict (171)
    Domains in SCOPe 2.07: d6cqfa_
  • Heterogens: F97, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cqfA (A:)
    gsdvvdpdifnrdprdhydllqrlgggtygevfkardkvsgdlvalkmvkmepdddvstl
    qkeililktcrhanivayhgsylwlqklwicmefcgagslqdiyqvtgslselqisyvcr
    evlqglaylhsqkkihrdikganilindagevrladfgisaqigatlarrlafigtpywm
    apevaavalkggynelcdiwslgitaielaelqpplfdvhplrvlflmtksgyqpprlke
    kgkwsaafhnfikvtltkspkkrpsatkmlshqlvsqpglnrglildlldklkngns
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqfA (A:)
    pdifnrdprdhydllqrlgggtygevfkardkvsgdlvalkmvkmepdddvstlqkeili
    lktcrhanivayhgsylwlqklwicmefcgagslqdiyqvtgslselqisyvcrevlqgl
    aylhsqkkihrdikganilindagevrladfgisaqirlafigtpywmapevaavalkgg
    ynelcdiwslgitaielaelqpplfdvhplrvlflmtksgyqpprlkekgkwsaafhnfi
    kvtltkspkkrpsatkmlshqlvsqpglnrglildlldklkn