PDB entry 6cqc

View 6cqc on RCSB PDB site
Description: RNase P protein from Thermotoga maritima in complex with 1-(4-Fluorophenyl)-2-thiourea
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2018-03-14, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: rnpA, TM_1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqca_
  • Chain 'B':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: rnpA, TM_1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqcb_
  • Chain 'C':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: rnpA, TM_1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqcc_
  • Chain 'D':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: rnpA, TM_1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cqcd_
  • Heterogens: SO4, 8P4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cqcA (A:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqcA (A:)
    rerlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwv
    reifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cqcB (B:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqcB (B:)
    rlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvre
    ifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cqcC (C:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqcC (C:)
    rlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvre
    ifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cqcD (D:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqcD (D:)
    rlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvre
    ifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrie