PDB entry 6cqb

View 6cqb on RCSB PDB site
Description: Crystal Structure of Piper methysticum Chalcone Synthase
Class: transferase
Keywords: phenylpropanoid pathway, flavokavain biosynthesis, TRANSFERASE
Deposited on 2018-03-14, released 2018-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.9099999999999997 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Piper methysticum [TaxId:130404]
    Gene: CHS
    Database cross-references and differences (RAF-indexed):
    • PDB 6CQB
    Domains in SCOPe 2.08: d6cqba1, d6cqba2
  • Chain 'B':
    Compound: chalcone synthase
    Species: Piper methysticum [TaxId:130404]
    Gene: CHS
    Database cross-references and differences (RAF-indexed):
    • PDB 6CQB
    Domains in SCOPe 2.08: d6cqbb1, d6cqbb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cqbA (A:)
    msktveeiwaaqrargpatvlaigtaapanvvyqadypdyyfritksehmtelkekfrrm
    cdksmitkrhmhlseellknnpdicaymapsldarqdmvvvevpklgkeaaakaikewgr
    pksaithlifcttsgvdmpgadfqltkllglcpsvrrtmlyqqgcfaggtvlrlakdlae
    nnagarvlvvcseitavtfrgpsethldsmvgqalfgdgasaiivgadpdpvierplfqi
    vsaaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslkeafaplgiddwnsif
    wivhpggpaildqveaklrlkveklkttrtvlseygnmssacvlfildemrrnsmeegka
    ttgeglhwgvlfgfgpgltvetvvlhslpiaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqbA (A:)
    aaqrargpatvlaigtaapanvvyqadypdyyfritksehmtelkekfrrmcdksmitkr
    hmhlseellknnpdicaymapsldarqdmvvvevpklgkeaaakaikewgrpksaithli
    fcttsgvdmpgadfqltkllglcpsvrrtmlyqqgcfaggtvlrlakdlaennagarvlv
    vcseitavtfrgpsethldsmvgqalfgdgasaiivgadpdpvierplfqivsaaqtilp
    dsdgaidghlrevgltfhllkdvpgliskniekslkeafaplgiddwnsifwivhpggpa
    ildqveaklrlkveklkttrtvlseygnmssacvlfildemrrnsmeegkattgeglhwg
    vlfgfgpgltvetvvlhslpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cqbB (B:)
    msktveeiwaaqrargpatvlaigtaapanvvyqadypdyyfritksehmtelkekfrrm
    cdksmitkrhmhlseellknnpdicaymapsldarqdmvvvevpklgkeaaakaikewgr
    pksaithlifcttsgvdmpgadfqltkllglcpsvrrtmlyqqgcfaggtvlrlakdlae
    nnagarvlvvcseitavtfrgpsethldsmvgqalfgdgasaiivgadpdpvierplfqi
    vsaaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslkeafaplgiddwnsif
    wivhpggpaildqveaklrlkveklkttrtvlseygnmssacvlfildemrrnsmeegka
    ttgeglhwgvlfgfgpgltvetvvlhslpiaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cqbB (B:)
    aaqrargpatvlaigtaapanvvyqadypdyyfritksehmtelkekfrrmcdksmitkr
    hmhlseellknnpdicaymapsldarqdmvvvevpklgkeaaakaikewgrpksaithli
    fcttsgvdmpgadfqltkllglcpsvrrtmlyqqgcfaggtvlrlakdlaennagarvlv
    vcseitavtfrgpsethldsmvgqalfgdgasaiivgadpdpvierplfqivsaaqtilp
    dsdgaidghlrevgltfhllkdvpgliskniekslkeafaplgiddwnsifwivhpggpa
    ildqveaklrlkveklkttrtvlseygnmssacvlfildemrrnsmeegkattgeglhwg
    vlfgfgpgltvetvvlhslpi