PDB entry 6cpy

View 6cpy on RCSB PDB site
Description: Structure of apo GRMZM2G135359 pseudokinase
Class: transferase
Keywords: Receptor-like kinase, pseudokinase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-03-14, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GRMZM2G135359 pseudokinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4F901 (2-307)
      • expression tag (0-1)
  • Chain 'B':
    Compound: GRMZM2G135359 pseudokinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cpyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cpyB (B:)
    smrakkmgtvrpwatglsgqlqkafvtgvpslkrseletacedfsniigststcmlykgt
    lssgveiavasslvtsakdwskenesqyrkkitnlskvshknfmnllgyceeehpftrvm
    vfeyapngtlfehlhvreaekldwmarlrismgiayclehmhqlqtpaalrnfdsttvyl
    tddfaakvsdlefwndakghnsttnnelafspdmedivrkygmvlleiltgrvpsseddg
    plenwvsryfeggmrleelidpsigffpedtaralcevvrscidrdpkkrpqmkevaarm
    reitalgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpyB (B:)
    fvtgvpslkrseletacedfsniigststcmlykgtlssgveiavasslvtsakdwsken
    esqyrkkitnlskvshknfmnllgyceeehpftrvmvfeyapngtlfehlhvreaekldw
    marlrismgiayclehmhqlqtpaalrnfdsttvyltddfaakvsdlefwnspdmedivr
    kygmvlleiltgrvplenwvsryfeggmrleelidpsigffpedtaralcevvrscidrd
    pkkrpqmkevaarmreitalgp